| Class b: All beta proteins [48724] (180 folds) |
| Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
| Family b.21.1.1: Adenovirus fiber protein 'knob' domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
| Protein Adenovirus fiber protein 'knob' domain [49837] (18 species) |
| Species Human adenovirus type 11P [TaxId:343462] [158980] (1 PDB entry) Uniprot P35774 129-325 |
| Domain d2o39a1: 2o39 A:129-325 [145712] Other proteins in same PDB: d2o39c1, d2o39c2, d2o39d1, d2o39d2 complexed with ca |
PDB Entry: 2o39 (more details), 2.85 Å
SCOPe Domain Sequences for d2o39a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2o39a1 b.21.1.1 (A:129-325) Adenovirus fiber protein 'knob' domain {Human adenovirus type 11P [TaxId: 343462]}
dnintlwtgvnpteancqimnssesndckliltlvktgalvtafvyvigvsnnfnmltth
rninftaelffdstgnlltrlsslktplnhksgqnmatgaitnakgfmpsttaypfndns
rekenyiygtcyytasdrtafpidisvmlnrraindetsyciritwswntgdapevqtsa
ttlvtspftfyyiredd
Timeline for d2o39a1: