Lineage for d2nyld1 (2nyl D:9-589)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006480Family a.118.1.2: HEAT repeat [48385] (2 protein domains)
    Pfam PF02985
  6. 2006481Protein Constant regulatory domain of protein phosphatase 2a, pr65alpha [48386] (2 species)
  7. 2006482Species Human (Homo sapiens) [TaxId:9606] [48387] (12 PDB entries)
  8. 2006502Domain d2nyld1: 2nyl D:9-589 [138818]
    Other proteins in same PDB: d2nylb1, d2nylc1, d2nyle1, d2nylf1
    automatically matched to d1b3ua_
    complexed with mn

Details for d2nyld1

PDB Entry: 2nyl (more details), 3.8 Å

PDB Description: crystal structure of protein phosphatase 2a (pp2a) holoenzyme with the catalytic subunit carboxyl terminus truncated
PDB Compounds: (D:) Protein Phosphatase 2, regulatory subunit A (PR 65), alpha isoform

SCOPe Domain Sequences for d2nyld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nyld1 a.118.1.2 (D:9-589) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]}
slypiavlidelrnedvqlrlnsikklstialalgvertrsellpfltdtiydedevlla
laeqlgtfttlvggpeyvhcllppleslatveetvvrdkaveslraishehspsdleahf
vplvkrlaggdwftsrtsacglfsvcyprvssavkaelrqyfrnlcsddtpmvrraaask
lgefakvleldnvkseiipmfsnlasdeqdsvrllaveacvniaqllpqedlealvmptl
rqaaedkswrvrymvadkftelqkavgpeitktdlvpafqnlmkdceaevraaashkvke
fcenlsadcrenvimsqilpcikelvsdanqhvksalasvimglspilgkdntiehllpl
flaqlkdecpevrlniisnldcvnevigirqlsqsllpaivelaedakwrvrlaiieymp
llagqlgveffdeklnslcmawlvdhvyaireaatsnlkklvekfgkewahatiipkvla
msgdpnylhrmttlfcinvlsevcgqdittkhmlptvlrmagdpvanvrfnvakslqkig
pildnstlqsevkpilekltqdqdvdvkyfaqealtvlsla

SCOPe Domain Coordinates for d2nyld1:

Click to download the PDB-style file with coordinates for d2nyld1.
(The format of our PDB-style files is described here.)

Timeline for d2nyld1: