SCOPe 2.08: Domain d2ny4c1: 2ny4 C:2001-2111

Lineage for d2ny4c1 (2ny4 C:2001-2111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (31 PDB entries)

8. Domain d2ny4c1: 2ny4 C:2001-2111 [138784]
   Other proteins in same PDB: d2ny4a1, d2ny4b1, d2ny4b2, d2ny4c2, d2ny4d1, d2ny4d2
   automated match to d1rz8a1
   complexed with hez, nag

Details for d2ny4c1

PDB Entry: 2ny4, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e268c, s334a, s375w) complexed with cd4 and antibody 17b

PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2ny4c1:

Sequence; same for both SEQRES and ATOM records:

>d2ny4c1 b.1.1.1 (C:2001-2111) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]}
divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa
rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleikrt

Timeline for d2ny4c1:

• d2ny4c1 first appeared in SCOP 1.73
  
• d2ny4c1 appears in SCOPe 2.07