![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Human (Homo sapiens), cluster 3.2 [TaxId:9606] [88523] (29 PDB entries) |
![]() | Domain d2ny4c1: 2ny4 C:2001-2109 [138784] Other proteins in same PDB: d2ny4b1, d2ny4b2, d2ny4c2, d2ny4d1, d2ny4d2 automatically matched to d1g9ml1 complexed with hez, nag, suc; mutant |
PDB Entry: 2ny4 (more details), 2 Å
SCOP Domain Sequences for d2ny4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ny4c1 b.1.1.1 (C:2001-2109) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} divmtqspatlsvspgeratlscrasesvssdlawyqqkpgqaprlliygastratgvpa rfsgsgsgaeftltisslqsedfavyycqqynnwpprytfgqgtrleik
Timeline for d2ny4c1:
![]() Domains from other chains: (mouse over for more information) d2ny4b1, d2ny4b2, d2ny4d1, d2ny4d2 |