SCOPe 2.08: Domain d2ny4b1: 2ny4 B:1001-1097

Lineage for d2ny4b1 (2ny4 B:1001-1097)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein CD4 V-set domains [48737] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48738] (33 PDB entries)

8. Domain d2ny4b1: 2ny4 B:1001-1097 [138782]
   Other proteins in same PDB: d2ny4a1, d2ny4b2, d2ny4c1, d2ny4c2, d2ny4d1, d2ny4d2
   complexed with hez, nag

Details for d2ny4b1

PDB Entry: 2ny4, 2 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (k231c, t257s, e268c, s334a, s375w) complexed with cd4 and antibody 17b

PDB Compounds: (B:) T-cell surface glycoprotein cd4

SCOPe Domain Sequences for d2ny4b1:

Sequence; same for both SEQRES and ATOM records:

>d2ny4b1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]}
kkvvlgkkgdtveltctasqkksiqfhwknsnqikilgnqgsfltkgpsklndradsrrs
lwdqgnfpliiknlkiedsdtyicevedqkeevqllv

Timeline for d2ny4b1:

• d2ny4b1 first appeared in SCOP 1.73
  
• d2ny4b1 appears in SCOPe 2.07