Lineage for d2nxzc2 (2nxz C:2110-2214)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 934293Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)
  7. 934303Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody
  8. 934338Domain d2nxzc2: 2nxz C:2110-2214 [138754]
    Other proteins in same PDB: d2nxza1, d2nxzb1, d2nxzb2, d2nxzc1, d2nxzd1, d2nxzd2
    automatically matched to d1g9ml2
    complexed with edo, hez, ipa, nag, suc

Details for d2nxzc2

PDB Entry: 2nxz (more details), 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOPe Domain Sequences for d2nxzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxzc2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d2nxzc2:

Click to download the PDB-style file with coordinates for d2nxzc2.
(The format of our PDB-style files is described here.)

Timeline for d2nxzc2: