Lineage for d2nxzc2 (2nxz C:2110-2214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 655939Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655976Domain d2nxzc2: 2nxz C:2110-2214 [138754]
    Other proteins in same PDB: d2nxzb1, d2nxzb2, d2nxzc1, d2nxzd1, d2nxzd2
    automatically matched to d1g9ml2
    complexed with edo, hez, ipa, nag, suc; mutant

Details for d2nxzc2

PDB Entry: 2nxz (more details), 2.04 Å

PDB Description: hiv-1 gp120 envelope glycoprotein (t257s, s334a, s375w) complexed with cd4 and antibody 17b
PDB Compounds: (C:) antibody 17b, light chain

SCOP Domain Sequences for d2nxzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nxzc2 b.1.1.2 (C:2110-2214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOP Domain Coordinates for d2nxzc2:

Click to download the PDB-style file with coordinates for d2nxzc2.
(The format of our PDB-style files is described here.)

Timeline for d2nxzc2: