| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) ![]() form homo and heterodimers |
| Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
| Protein RPB3 [64315] (2 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries) Uniprot P16370; part of multichain biological unit |
| Domain d2nvzc1: 2nvz C:3-37,C:173-268 [138695] Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1 automatically matched to d1i3qc1 protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn |
PDB Entry: 2nvz (more details), 4.3 Å
SCOPe Domain Sequences for d2nvzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvzc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd
Timeline for d2nvzc1: