Lineage for d2nvzc1 (2nvz C:3-37,C:173-268)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726910Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 726990Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 726991Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 727044Protein RPB3 [64315] (1 species)
  7. 727045Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64316] (24 PDB entries)
  8. 727070Domain d2nvzc1: 2nvz C:3-37,C:173-268 [138695]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1i3qc1
    complexed with mg, utp, zn

Details for d2nvzc1

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006
PDB Compounds: (C:) DNA-directed RNA polymerase II 45 kDa polypeptide

SCOP Domain Sequences for d2nvzc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nvzc1 d.74.3.1 (C:3-37,C:173-268) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eegpqvkireaskdnvdfilsnvdlamanslrrvmXaaaiefeydpwnklkhtdywyeqd
sakewpqsknceyedppnegdpfdykaqadtfymnvesvgsipvdqvvvrgidtlqkkva
sillaltqmdqd

SCOP Domain Coordinates for d2nvzc1:

Click to download the PDB-style file with coordinates for d2nvzc1.
(The format of our PDB-style files is described here.)

Timeline for d2nvzc1: