Lineage for d2nvze1 (2nvz E:3-143)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882964Superfamily c.52.3: Eukaryotic RPB5 N-terminal domain [53036] (1 family) (S)
  5. 2882965Family c.52.3.1: Eukaryotic RPB5 N-terminal domain [53037] (2 proteins)
  6. 2882966Protein Eukaryotic RPB5 N-terminal domain [53038] (2 species)
  7. 2882967Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [53039] (27 PDB entries)
    Uniprot P20434; part of multichain biological unit
  8. 2882994Domain d2nvze1: 2nvz E:3-143 [138697]
    Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze2, d2nvzf1, d2nvzh1, d2nvzi1, d2nvzi2, d2nvzj1, d2nvzk1, d2nvzl1
    automatically matched to d1i3qe1
    protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvze1

PDB Entry: 2nvz (more details), 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006
PDB Compounds: (E:) DNA-directed RNA polymerases I, II, and III 27 kDa polypeptide

SCOPe Domain Sequences for d2nvze1:

Sequence, based on SEQRES records: (download)

>d2nvze1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdsmgrpqrkmmsfqa
npteesiskfpdmgslwvefcdepsvgvktmktfvihiqeknfqtgifvyqnnitpsamk
lvpsippatietfneaalvvn

Sequence, based on observed residues (ATOM records): (download)

>d2nvze1 c.52.3.1 (E:3-143) Eukaryotic RPB5 N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qenernisrlwrafrtvkemvkdrgyfitqeevelpledfkakycdrpqrkmmsfqanpt
eesiskfpdmgslwveftfvihiqeknfqtgifvtpsamklvpsippatietfneaalvv
n

SCOPe Domain Coordinates for d2nvze1:

Click to download the PDB-style file with coordinates for d2nvze1.
(The format of our PDB-style files is described here.)

Timeline for d2nvze1: