SCOPe 2.08: Domain d2nvzi1: 2nvz I:2-49

Lineage for d2nvzi1 (2nvz I:2-49)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families)

5. Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins)

6. Protein RBP9 subunit of RNA polymerase II [57787] (3 species)
   contains two differently decorated domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries)
   Uniprot P27999; part of multichain biological unit

8. Domain d2nvzi1: 2nvz I:2-49 [138701]
   Other proteins in same PDB: d2nvza1, d2nvzb1, d2nvzc1, d2nvzc2, d2nvze1, d2nvze2, d2nvzf1, d2nvzh1, d2nvzj1, d2nvzk1, d2nvzl1
   automatically matched to d1i3qi1
   protein/DNA complex; protein/RNA complex; complexed with mg, utp, zn

Details for d2nvzi1

PDB Entry: 2nvz, 4.3 Å

PDB Description: rna polymerase ii elongation complex with utp, updated 11/2006

PDB Compounds: (I:) DNA-directed RNA polymerase II subunit 9

SCOPe Domain Sequences for d2nvzi1:

Sequence; same for both SEQRES and ATOM records:

>d2nvzi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli

Timeline for d2nvzi1:

• d2nvzi1 first appeared in SCOP 1.73
  
• d2nvzi1 appears in SCOPe 2.07