![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.3: Zinc beta-ribbon [57783] (6 families) ![]() |
![]() | Family g.41.3.1: Transcriptional factor domain [57784] (6 proteins) |
![]() | Protein RBP9 subunit of RNA polymerase II [57787] (3 species) contains two differently decorated domains of this fold |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64575] (24 PDB entries) Uniprot P27999; part of multichain biological unit |
![]() | Domain d2nvyi1: 2nvy I:2-49 [138688] Other proteins in same PDB: d2nvya1, d2nvyb1, d2nvyc1, d2nvyc2, d2nvye1, d2nvye2, d2nvyf1, d2nvyh1, d2nvyj1, d2nvyk1, d2nvyl1 automatically matched to d1i3qi1 protein/DNA complex; protein/RNA complex; complexed with mn, zn |
PDB Entry: 2nvy (more details), 3.4 Å
SCOPe Domain Sequences for d2nvyi1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nvyi1 g.41.3.1 (I:2-49) RBP9 subunit of RNA polymerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttfrfcrdcnnmlypredkennrllfecrtcsyveeagsplvyrheli
Timeline for d2nvyi1: