SCOPe 2.08: Domain d2nu1e_: 2nu1 E:

Lineage for d2nu1e_ (2nu1 E:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)

6. Protein automated matches [190306] (9 species)
   not a true protein

7. Species Streptomyces griseus [TaxId:1911] [187119] (8 PDB entries)

8. Domain d2nu1e_: 2nu1 E: [138598]
   Other proteins in same PDB: d2nu1i1
   automated match to d1sgde_

Details for d2nu1e_

PDB Entry: 2nu1, 1.8 Å

PDB Description: molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i

PDB Compounds: (E:) Streptogrisin B

SCOPe Domain Sequences for d2nu1e_:

Sequence; same for both SEQRES and ATOM records:

>d2nu1e_ b.47.1.1 (E:) automated matches {Streptomyces griseus [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2nu1e_:

• d2nu1e_ first appeared in SCOP 1.73, called d2nu1e1
  
• d2nu1e_ appears in SCOPe 2.07