SCOP 1.73: Domain d2nu1e1: 2nu1 E:16-242

Lineage for d2nu1e1 (2nu1 E:16-242)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.1: Prokaryotic proteases [50495] (15 proteins)

6. Protein Protease B [50508] (1 species)

7. Species Streptomyces griseus, strain k1 [TaxId:1911] [50509] (26 PDB entries)
   Streptogrisin B

8. Domain d2nu1e1: 2nu1 E:16-242 [138598]
   automatically matched to d1sgde_
   mutant

Details for d2nu1e1

PDB Entry: 2nu1, 1.8 Å

PDB Description: molecular structures of the complexes of sgpb with omtky3 aromatic p1 variants trp18i, his18i, phe18i and tyr18i

PDB Compounds: (E:) Streptogrisin B

SCOP Domain Sequences for d2nu1e1:

Sequence; same for both SEQRES and ATOM records:

>d2nu1e1 b.47.1.1 (E:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]}
isggdaiysstgrcslgfnvrsgstyyfltaghctdgattwwansarttvlgttsgssfp
nndygivrytnttipkdgtvggqditsaanatvgmavtrrgsttgthsgsvtalnatvny
gggdvvygmirtnvcaepgdsggplysgtraigltsggsgncssggttffqpvtealsay
gvsvy

Timeline for d2nu1e1:

• d2nu1e1 is new in SCOP 1.73
  
• d2nu1e1 appears in SCOP 1.75
  
• d2nu1e1 appears in the current release, SCOPe 2.08, called d2nu1e_