| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family) ![]() has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile automatically mapped to Pfam PF07826 |
| Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein) Pfam PF07826 |
| Protein Hypothetical protein MTH1020 [75571] (1 species) |
| Species Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries) |
| Domain d2ntma_: 2ntm A: [138591] Other proteins in same PDB: d2ntmd3 |
PDB Entry: 2ntm (more details), 2.6 Å
SCOPe Domain Sequences for d2ntma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ntma_ d.153.2.1 (A:) Hypothetical protein MTH1020 {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn
cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings
eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft
hpvtaaaafndgegwnlatrem
Timeline for d2ntma_:
View in 3DDomains from other chains: (mouse over for more information) d2ntmb_, d2ntmc_, d2ntmd2, d2ntmd3 |