Lineage for d2ntma1 (2ntm A:1-202)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 736504Superfamily d.153.2: Archaeal IMP cyclohydrolase PurO [75569] (1 family) (S)
    has a putative active site in the same topological location as the Ntn hydrolase but lacks the N-terminal nucleophile
  5. 736505Family d.153.2.1: Archaeal IMP cyclohydrolase PurO [75570] (1 protein)
    Pfam PF07826
  6. 736506Protein Hypothetical protein MTH1020 [75571] (1 species)
  7. 736507Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75572] (4 PDB entries)
  8. 736517Domain d2ntma1: 2ntm A:1-202 [138591]
    automatically matched to d1kuua_

Details for d2ntma1

PDB Entry: 2ntm (more details), 2.6 Å

PDB Description: Crystal structure of PurO from Methanothermobacter thermoautotrophicus
PDB Compounds: (A:) IMP cyclohydrolase

SCOP Domain Sequences for d2ntma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ntma1 d.153.2.1 (A:1-202) Hypothetical protein MTH1020 {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]}
mylgrilavgrnsngsfvayrvssrsfpnrttsiqeervavvpvegherdvfrnpyiayn
cirivgdtavvsngshtdtiadkvalgmnlrdaiglsllamdyekdelntpriaaaings
eafigivtadglmvsrvpeetpvyistyeqtepaatefkagspeeaaefilkggefaaft
hpvtaaaafndgegwnlatrem

SCOP Domain Coordinates for d2ntma1:

Click to download the PDB-style file with coordinates for d2ntma1.
(The format of our PDB-style files is described here.)

Timeline for d2ntma1: