SCOPe 2.08: Domain d2ji3c1: 2ji3 C:38-126

Lineage for d2ji3c1 (2ji3 C:38-126)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.13: Superoxide reductase-like [49367] (2 families)

5. Family b.1.13.1: Superoxide reductase-like [49368] (3 proteins)
   binds iron in the site that is topologically equivalent to the copper-binding site of cupredoxins
   automatically mapped to Pfam PF01880

6. Protein automated matches [190694] (3 species)
   not a true protein

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255263] (3 PDB entries)

8. Domain d2ji3c1: 2ji3 C:38-126 [138351]
   Other proteins in same PDB: d2ji3a2, d2ji3b2, d2ji3c2, d2ji3d2
   automated match to d1vzga1
   complexed with ca, fe, no3, per; mutant

Details for d2ji3c1

PDB Entry: 2ji3, 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii

PDB Compounds: (C:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji3c1:

Sequence; same for both SEQRES and ATOM records:

>d2ji3c1 b.1.13.1 (C:38-126) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
sentvdaakekhvpviekidggykvkvgavahpmeekhyiqwielladdkcytqflkpgq
apeavflieaakvvaraycnihghwkaen

Timeline for d2ji3c1:

• d2ji3c1 first appeared in SCOP 1.73
  
• d2ji3c1 appears in SCOPe 2.07