SCOPe 2.08: Domain d2ji3b2: 2ji3 B:2-37

Lineage for d2ji3b2 (2ji3 B:2-37)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.0: automated matches [232942] (1 protein)
   not a true family

6. Protein automated matches [232943] (4 species)
   not a true protein

7. Species Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId:887] [255262] (3 PDB entries)

8. Domain d2ji3b2: 2ji3 B:2-37 [138350]
   Other proteins in same PDB: d2ji3a1, d2ji3b1, d2ji3c1, d2ji3d1
   automated match to d1vzga2
   complexed with ca, fe, no3, per; mutant

Details for d2ji3b2

PDB Entry: 2ji3, 1.95 Å

PDB Description: x-ray structure of the iron-peroxide intermediate of superoxide reductase (e114a mutant) from desulfoarculus baarsii

PDB Compounds: (B:) desulfoferrodoxin

SCOPe Domain Sequences for d2ji3b2:

Sequence; same for both SEQRES and ATOM records:

>d2ji3b2 g.41.5.0 (B:2-37) automated matches {Desulfoarculus baarsii (Desulfovibrio baarsii) [TaxId: 887]}
perlqvykcevcgnivevlnggigelvccnqdmklm

Timeline for d2ji3b2:

• d2ji3b2 first appeared in SCOP 1.73
  
• d2ji3b2 appears in SCOPe 2.07