Lineage for d2jfga2 (2jfg A:298-437)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143554Fold c.59: MurD-like peptide ligases, peptide-binding domain [53243] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands, order 126345; strand 1 is antiparallel to the rest
  4. 2143555Superfamily c.59.1: MurD-like peptide ligases, peptide-binding domain [53244] (3 families) (S)
  5. 2143598Family c.59.1.0: automated matches [254241] (1 protein)
    not a true family
  6. 2143599Protein automated matches [254550] (5 species)
    not a true protein
  7. 2143600Species Escherichia coli [TaxId:562] [255259] (8 PDB entries)
  8. 2143602Domain d2jfga2: 2jfg A:298-437 [138307]
    Other proteins in same PDB: d2jfga1, d2jfga3, d2jfga4
    automated match to d2jfga2
    complexed with adp, so4, uma

Details for d2jfga2

PDB Entry: 2jfg (more details), 1.52 Å

PDB Description: crystal structure of murd ligase in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jfga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfga2 c.59.1.0 (A:298-437) automated matches {Escherichia coli [TaxId: 562]}
glphrfevvlehngvrwindskatnvgsteaalnglhvdgtlhlllggdgksadfsplar
ylngdnvrlycfgrdgaqlaalrpevaeqtetmeqamrllaprvqpgdmvllspacasld
qfknfeqrgnefarlakelg

SCOPe Domain Coordinates for d2jfga2:

Click to download the PDB-style file with coordinates for d2jfga2.
(The format of our PDB-style files is described here.)

Timeline for d2jfga2: