SCOPe 2.06: Domain d2jfga3: 2jfg A:94-297

Lineage for d2jfga3 (2jfg A:94-297)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.2: MurD-like peptide ligases, catalytic domain [53623] (3 families)
   has extra strand located between strands 1 and 2

5. Family c.72.2.1: MurCDEF [53624] (5 proteins)
   automatically mapped to Pfam PF08245

6. Protein automated matches [254549] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255258] (8 PDB entries)

8. Domain d2jfga3: 2jfg A:94-297 [138308]
   Other proteins in same PDB: d2jfga1, d2jfga2, d2jfga4
   automated match to d2jfga3
   complexed with adp, so4, uma

Details for d2jfga3

PDB Entry: 2jfg, 1.52 Å

PDB Description: crystal structure of murd ligase in complex with uma and adp

PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jfga3:

Sequence; same for both SEQRES and ATOM records:

>d2jfga3 c.72.2.1 (A:94-297) automated matches {Escherichia coli [TaxId: 562]}
dielfcreaqapivaitgsngkstvttlvgemakaagvnvgvggniglpalmllddecel
yvlelssfqlettsslqavaatilnvtedhmdrypfglqqyraaklriyenakvcvvnad
daltmpirgadercvsfgvnmgdyhlnhqqgetwlrvkgekvlnvkemklsgqhnytnal
aalaladaaglprasslkalttft

Timeline for d2jfga3:

• d2jfga3 first appeared in SCOP 1.73
  
• d2jfga3 appears in SCOPe 2.05
  
• d2jfga3 appears in SCOPe 2.07
  
• d2jfga3 appears in the current release, SCOPe 2.08