Lineage for d2jfga1 (2jfg A:1-93)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 979405Fold c.5: MurCD N-terminal domain [51983] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32145; incomplete Rossmann-like fold; binds UDP group
  4. 979406Superfamily c.5.1: MurCD N-terminal domain [51984] (1 family) (S)
  5. 979407Family c.5.1.1: MurCD N-terminal domain [51985] (2 proteins)
  6. 979420Protein UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD [51986] (1 species)
  7. 979421Species Escherichia coli [TaxId:562] [51987] (11 PDB entries)
  8. 979422Domain d2jfga1: 2jfg A:1-93 [138306]
    Other proteins in same PDB: d2jfga2, d2jfga3
    automatically matched to d1e0da1
    complexed with adp, so4, uma

Details for d2jfga1

PDB Entry: 2jfg (more details), 1.52 Å

PDB Description: crystal structure of murd ligase in complex with uma and adp
PDB Compounds: (A:) udp-n-acetylmuramoylalanine--d-glutamate ligase

SCOPe Domain Sequences for d2jfga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]}
adyqgknvviiglgltglscvdfflargvtprvmdtrmtppgldklpeaverhtgslnde
wlmaadlivaspgialahpslsaaadagieivg

SCOPe Domain Coordinates for d2jfga1:

Click to download the PDB-style file with coordinates for d2jfga1.
(The format of our PDB-style files is described here.)

Timeline for d2jfga1: