SCOPe 2.01: Domain d2ja7j1: 2ja7 J:1-65

Lineage for d2ja7j1 (2ja7 J:1-65)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family)

5. Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
   Zn-binding site is near the N-terminus

6. Protein RNA polymerase subunit RPB10 [46926] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (27 PDB entries)
   Uniprot P22139; part of multichain biological unit

8. Domain d2ja7j1: 2ja7 J:1-65 [138203]
   Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7w1, d2ja7x1
   automatically matched to d1i3qj_
   protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7j1

PDB Entry: 2ja7, 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c

PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2ja7j1:

Sequence; same for both SEQRES and ATOM records:

>d2ja7j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

Timeline for d2ja7j1:

• d2ja7j1 first appeared in SCOP 1.73
  
• d2ja7j1 appears in SCOP 1.75
  
• d2ja7j1 appears in SCOPe 2.02
  
• d2ja7j1 appears in the current release, SCOPe 2.08