Lineage for d2ja7j1 (2ja7 J:1-65)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2695676Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
    automatically mapped to Pfam PF01194
  5. 2695677Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 2695678Protein RNA polymerase subunit RPB10 [46926] (3 species)
  7. 2695679Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 2695701Domain d2ja7j1: 2ja7 J:1-65 [138203]
    Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7w1, d2ja7x1
    automatically matched to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja7j1

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2ja7j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja7j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2ja7j1:

Click to download the PDB-style file with coordinates for d2ja7j1.
(The format of our PDB-style files is described here.)

Timeline for d2ja7j1: