Lineage for d2ja7j1 (2ja7 J:1-65)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 763391Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 763392Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (1 protein)
    Zn-binding site is near the N-terminus
  6. 763393Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 763396Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (29 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 763416Domain d2ja7j1: 2ja7 J:1-65 [138203]
    Other proteins in same PDB: d2ja7a1, d2ja7b1, d2ja7c1, d2ja7c2, d2ja7d1, d2ja7e1, d2ja7e2, d2ja7f1, d2ja7g1, d2ja7g2, d2ja7h1, d2ja7i1, d2ja7i2, d2ja7k1, d2ja7l1, d2ja7m1, d2ja7n1, d2ja7o1, d2ja7o2, d2ja7p1, d2ja7q1, d2ja7q2, d2ja7r1, d2ja7s1, d2ja7s2, d2ja7t1, d2ja7u1, d2ja7u2, d2ja7w1, d2ja7x1
    automatically matched to d1i3qj_
    complexed with bru, mg, tt, zn

Details for d2ja7j1

PDB Entry: 2ja7 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex c
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOP Domain Sequences for d2ja7j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja7j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d2ja7j1:

Click to download the PDB-style file with coordinates for d2ja7j1.
(The format of our PDB-style files is described here.)

Timeline for d2ja7j1: