| Class b: All beta proteins [48724] (174 folds) |
| Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
| Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins) barrel, closed; n=5, S=8 |
| Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries) Uniprot P34087 |
| Domain d2ja6g1: 2ja6 G:81-171 [138182] Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1 automatically matched to d1y14b1 protein/DNA complex; protein/RNA complex; complexed with mg, zn |
PDB Entry: 2ja6 (more details), 4 Å
SCOPe Domain Sequences for d2ja6g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ja6g1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai
Timeline for d2ja6g1: