SCOPe 2.02: Domain d2ja6g1: 2ja6 G:81-171

Lineage for d2ja6g1 (2ja6 G:81-171)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.40: OB-fold [50198] (16 superfamilies)
barrel, closed or partly opened n=5, S=10 or S=8; greek-key
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families)
Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (31 proteins)
barrel, closed; n=5, S=8
Protein C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) [88670] (3 species)
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117195] (6 PDB entries)
Uniprot P34087

Domain d2ja6g1: 2ja6 G:81-171 [138182]
Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g2, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
automatically matched to d1y14b1
protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6g1

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b

PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOPe Domain Sequences for d2ja6g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6g1 b.40.4.5 (G:81-171) C-terminal domain of RNA polymerase II subunit RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pfkgevvdgtvvscsqhgfevqvgpmkvfvtkhlmpqdltfnagsnppsyqssedvitik
srirvkiegcisqvssihaigsikedylgai

SCOPe Domain Coordinates for d2ja6g1:

Click to download the PDB-style file with coordinates for d2ja6g1.
(The format of our PDB-style files is described here.)

Timeline for d2ja6g1: