Lineage for d2ja6g2 (2ja6 G:1-80)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1051631Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 1051632Superfamily d.230.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88798] (1 family) (S)
  5. 1051633Family d.230.1.1: N-terminal, heterodimerisation domain of RBP7 (RpoE) [88799] (1 protein)
  6. 1051634Protein N-terminal, heterodimerisation domain of RBP7 (RpoE) [88800] (3 species)
  7. 1051635Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [117777] (6 PDB entries)
    Uniprot P34087
  8. 1051643Domain d2ja6g2: 2ja6 G:1-80 [138183]
    Other proteins in same PDB: d2ja6a1, d2ja6b1, d2ja6c1, d2ja6c2, d2ja6d1, d2ja6e1, d2ja6e2, d2ja6f1, d2ja6g1, d2ja6h1, d2ja6i1, d2ja6i2, d2ja6j1, d2ja6k1, d2ja6l1
    automatically matched to d1y14b2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja6g2

PDB Entry: 2ja6 (more details), 4 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex b
PDB Compounds: (G:) DNA-directed RNA polymerase II 19kda polypeptide

SCOPe Domain Sequences for d2ja6g2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja6g2 d.230.1.1 (G:1-80) N-terminal, heterodimerisation domain of RBP7 (RpoE) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mffikdlslnitlhpsffgprmkqylktklleevegsctgkfgyilcvldydnidiqrgr
ilptdgsaefnvkyravvfk

SCOPe Domain Coordinates for d2ja6g2:

Click to download the PDB-style file with coordinates for d2ja6g2.
(The format of our PDB-style files is described here.)

Timeline for d2ja6g2: