Lineage for d2ja5j1 (2ja5 J:1-65)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1078587Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1081028Superfamily a.4.11: RNA polymerase subunit RPB10 [46924] (1 family) (S)
  5. 1081029Family a.4.11.1: RNA polymerase subunit RPB10 [46925] (2 proteins)
    Zn-binding site is near the N-terminus
  6. 1081030Protein RNA polymerase subunit RPB10 [46926] (2 species)
  7. 1081031Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63490] (27 PDB entries)
    Uniprot P22139; part of multichain biological unit
  8. 1081053Domain d2ja5j1: 2ja5 J:1-65 [138171]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5k1, d2ja5l1
    automatically matched to d1i3qj_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5j1

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (J:) DNA-directed RNA polymerases I/II/III subunit 10

SCOPe Domain Sequences for d2ja5j1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5j1 a.4.11.1 (J:1-65) RNA polymerase subunit RPB10 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOPe Domain Coordinates for d2ja5j1:

Click to download the PDB-style file with coordinates for d2ja5j1.
(The format of our PDB-style files is described here.)

Timeline for d2ja5j1: