Lineage for d2ja5c2 (2ja5 C:42-172)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227977Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1227978Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
  5. 1227979Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1228032Protein RPB3 [64462] (1 species)
  7. 1228033Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64463] (24 PDB entries)
    Uniprot P16370; part of multichain biological unit
  8. 1228052Domain d2ja5c2: 2ja5 C:42-172 [138161]
    Other proteins in same PDB: d2ja5a1, d2ja5b1, d2ja5c1, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1i3qc2
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5c2

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (C:) DNA-directed RNA polymerase II 45kda polypeptide

SCOPe Domain Sequences for d2ja5c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ja5c2 d.181.1.1 (C:42-172) RPB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ptlaidsvevetnttvladefiahrlgliplqsmdieqleysrdcfcedhcdkcsvvltl
qafgesesttnvyskdlvivsnlmgrnighpiiqdkegngvlicklrkgqelkltcvakk
giakehakwgp

SCOPe Domain Coordinates for d2ja5c2:

Click to download the PDB-style file with coordinates for d2ja5c2.
(The format of our PDB-style files is described here.)

Timeline for d2ja5c2: