Lineage for d2ja5b1 (2ja5 B:20-1224)

  1. Root: SCOPe 2.02
  2. 1232558Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1235883Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 1235884Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 1235885Family e.29.1.1: RNA-polymerase beta [64485] (3 proteins)
  6. 1235886Protein RBP2 [64491] (1 species)
  7. 1235887Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64492] (27 PDB entries)
    Uniprot P08518; part of multichain biological unit
  8. 1235909Domain d2ja5b1: 2ja5 B:20-1224 [138159]
    Other proteins in same PDB: d2ja5a1, d2ja5c1, d2ja5c2, d2ja5d1, d2ja5e1, d2ja5e2, d2ja5f1, d2ja5g1, d2ja5g2, d2ja5h1, d2ja5i1, d2ja5i2, d2ja5j1, d2ja5k1, d2ja5l1
    automatically matched to d1i50b_
    protein/DNA complex; protein/RNA complex; complexed with mg, zn

Details for d2ja5b1

PDB Entry: 2ja5 (more details), 3.8 Å

PDB Description: cpd lesion containing rna polymerase ii elongation complex a
PDB Compounds: (B:) DNA-directed RNA polymerase II 140 kDa polypeptide

SCOPe Domain Sequences for d2ja5b1:

Sequence, based on SEQRES records: (download)

>d2ja5b1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstlileqlaqhtt
esdnisrkyeisfgkiyvtkpmvnesdgvthalypqearlrnltyssglfvdvkkrtyea
idvpgrelkyeliaeeseddsesgkvfigrlpimlrskncylseatesdlyklkecpfdm
ggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgsrfistlqvkly
gregssartikatlpyikqdipiviifralgiipdgeilehicydvndwqmlemlkpcve
dgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqlegfesrkafflg
yminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdifrymqrtveea
hdfnmklainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlrrtn
tpigrdgklakprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitfls
ewgmepledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdi
rekelkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdieggfedveey
twssllneglveyidaeeeesiliamqpedlepaeaneendldvdpakrirvshhattft
hceihpsmilgvaasiipfpdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyyp
qkplgttrameylkfrelpagqnaivaiacysgynqedsmimnqssidrglfrslffrsy
mdqekkygmsitetfekpqrtntlrmkhgtydkldddgliapgvrvsgedviigkttpis
pdeeelgqrtayhskrdastplrstengivdqvlvttnqdglkfvkvrvrttkipqigdk
fasrhgqkgtigityrredmpftaegivpdliinphaipsrmtvahliecllskvaalsg
negdaspftditvegiskllrehgyqsrgfevmynghtgkklmaqiffgptyyqrlrhmv
ddkiharargpmqvltrqpvegrsrdgglrfgemerdcmiahgaasflkerlmeasdafr
vhicgicglmtviaklnhnqfeckgcdnkidiyqihipyaakllfqelmamnitprlytd
rsrdf

Sequence, based on observed residues (ATOM records): (download)

>d2ja5b1 e.29.1.1 (B:20-1224) RBP2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
desapitaedswavisaffrekglvsqqldsfnqfvdytlqdiicedstliisfgkiyvt
kpmvnesdgvthalypqearlrnltyssglfvdvkkvfigrlpimlrskncylseatesd
lyklkecpfdmggyfiingsekvliaqersagnivqvfkkaapspishvaeirsalekgs
rfistlqvklygregssartikatlpyikqdipiviifralgiipdgeilehicydvndw
qmlemlkpcvedgfviqdretaldfigrrgtalgikkekriqyakdilqkeflphitqle
gfesrkafflgyminrlllcaldrkdqddrdhfgkkrldlagpllaqlfktlfkkltkdi
frymqrtvelainaktitsglkyalatgnwgeqkkamssragvsqvlnrytysstlshlr
rtntpikprqlhnthwglvcpaetpegqacglvknlslmscisvgtdpmpiitflsewgm
epledyvphqspdatrvfvngvwhgvhrnparlmetlrtlrrkgdinpevsmirdireke
lkiftdagrvyrplfiveddeslghkelkvrkghiaklmateyqdeytwssllneglvey
idaeeeesiliamqpedlepaeadvdpakrirvshhattfthceihpsmilgvaasiipf
pdhnqsprntyqsamgkqamgvfltnynvrmdtmanilyypqkplgttrameylkfrelp
agqnaivaiacysgynqedsmimnqssidrglfrslffrsymdqekkygmsitetfekpq
rtntlrmkhgtydkldddgliapgvrvsgedviigkttpisskrdastplrstengivdq
vlvttnqdglkfvkvrvrttkipqigdkfasrhgqkgtigityrredmpftaegivpdli
inphaipsrmtvahliecllskvaalsgnegdaspftditvegiskllrehgyqsrgfev
mynghtgkklmaqiffgptyyqrlrhmvddkiharargpmqvltrqpvegrsrdgglrfg
emerdcmiahgaasflkerlmeasdafrvhicgicglmtviaklnhnqfeckgcdnkidi
yqihipyaakllfqelmamnitprlytdrsrdf

SCOPe Domain Coordinates for d2ja5b1:

Click to download the PDB-style file with coordinates for d2ja5b1.
(The format of our PDB-style files is described here.)

Timeline for d2ja5b1: