Lineage for d2j9qa2 (2j9q A:315-639)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2007336Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2007337Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 protein domains)
  6. 2007457Protein automated matches [190103] (4 species)
    not a true protein
  7. 2007462Species Human (Homo sapiens) [TaxId:9606] [186825] (11 PDB entries)
  8. 2007475Domain d2j9qa2: 2j9q A:315-639 [138152]
    Other proteins in same PDB: d2j9qa3
    automated match to d1fcha_
    complexed with sr

Details for d2j9qa2

PDB Entry: 2j9q (more details), 2.65 Å

PDB Description: a novel conformation for the tpr domain of pex5p
PDB Compounds: (A:) peroxisomal targeting signal 1 receptor

SCOPe Domain Sequences for d2j9qa2:

Sequence, based on SEQRES records: (download)

>d2j9qa2 a.118.8.1 (A:315-639) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltsatydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqy
lgttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytp
ayahlvtpaeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcgl
gvlfnlsgeydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpg
yirsrynlgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsml
gqsdaygaadardlstlltmfglpq

Sequence, based on observed residues (ATOM records): (download)

>d2j9qa2 a.118.8.1 (A:315-639) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltsatydkgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqy
lgttqaeneqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytp
ayahlvtpslflevkelflaavrldptsidpdvqcglgvlfnlsgeydkavdcftaalsv
rpndyllwnklgatlangnqseeavaayrralelqpgyirsrynlgiscinlgahreave
hflealnmqrksrggamseniwstlrlalsmlgqsdaygaadardlstlltmfglpq

SCOPe Domain Coordinates for d2j9qa2:

Click to download the PDB-style file with coordinates for d2j9qa2.
(The format of our PDB-style files is described here.)

Timeline for d2j9qa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j9qa3
View in 3D
Domains from other chains:
(mouse over for more information)
d2j9qb_