Lineage for d2j8xb_ (2j8x B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197845Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 1197846Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 1197847Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 1197850Species Bacteriophage pbs2 [TaxId:10684] [54445] (10 PDB entries)
  8. 1197862Domain d2j8xb_: 2j8x B: [138143]
    Other proteins in same PDB: d2j8xa1, d2j8xc1
    automated match to d1lqmh_
    protein/DNA complex; complexed with ure

Details for d2j8xb_

PDB Entry: 2j8x (more details), 2.3 Å

PDB Description: epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
PDB Compounds: (B:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2j8xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8xb_ d.17.5.1 (B:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

SCOPe Domain Coordinates for d2j8xb_:

Click to download the PDB-style file with coordinates for d2j8xb_.
(The format of our PDB-style files is described here.)

Timeline for d2j8xb_: