SCOP 1.73: Domain d2j8xb1: 2j8x B:2-84

Lineage for d2j8xb1 (2j8x B:2-84)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family)
   has an additional strand at the C-terminus and a helix inserted after the first strand

5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)

6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)

7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries)

8. Domain d2j8xb1: 2j8x B:2-84 [138143]
   automatically matched to d1lqmh_
   complexed with ure

Details for d2j8xb1

PDB Entry: 2j8x, 2.3 Å

PDB Description: epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2

PDB Compounds: (B:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d2j8xb1:

Sequence; same for both SEQRES and ATOM records:

>d2j8xb1 d.17.5.1 (B:2-84) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

Timeline for d2j8xb1:

• d2j8xb1 is new in SCOP 1.73
  
• d2j8xb1 appears in SCOP 1.75
  
• d2j8xb1 appears in the current release, SCOPe 2.08, called d2j8xb_