![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) ![]() has an additional strand at the C-terminus and a helix inserted after the first strand |
![]() | Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein) |
![]() | Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species) |
![]() | Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries) |
![]() | Domain d2j8xb1: 2j8x B:2-84 [138143] automatically matched to d1lqmh_ complexed with ure |
PDB Entry: 2j8x (more details), 2.3 Å
SCOP Domain Sequences for d2j8xb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j8xb1 d.17.5.1 (B:2-84) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]} tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd apeykpwalviqdsngenkikml
Timeline for d2j8xb1: