Lineage for d2j8xb_ (2j8x B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. Protein Uracil-DNA glycosylase inhibitor protein [54443] (3 species)
  7. Species Bacteriophage pbs2 [TaxId:10684] [54445] (12 PDB entries)
  8. Domain d2j8xb_: 2j8x B: [138143]
    Other proteins in same PDB: d2j8xa1, d2j8xc_
    automated match to d1lqmh_
    protein/DNA complex; complexed with ure

Details for d2j8xb_

PDB Entry: 2j8x (more details), 2.3 Å

PDB Description: epstein-barr virus uracil-dna glycosylase in complex with ugi from pbs-2
PDB Compounds: (B:) uracil-DNA glycosylase inhibitor

SCOPe Domain Sequences for d2j8xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j8xb_ d.17.5.1 (B:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
tnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmlltsd
apeykpwalviqdsngenkikml

SCOPe Domain Coordinates for d2j8xb_ are not available.

Timeline for d2j8xb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2j8xa1, d2j8xc_, d2j8xd_