Lineage for d1lqmh_ (1lqm H:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 719236Superfamily d.17.5: Uracil-DNA glycosylase inhibitor protein [54441] (1 family) (S)
    has an additional strand at the C-terminus and a helix inserted after the first strand
  5. 719237Family d.17.5.1: Uracil-DNA glycosylase inhibitor protein [54442] (1 protein)
  6. 719238Protein Uracil-DNA glycosylase inhibitor protein [54443] (2 species)
  7. 719241Species Bacteriophage pbs2 [TaxId:10684] [54445] (9 PDB entries)
  8. 719264Domain d1lqmh_: 1lqm H: [78148]
    Other proteins in same PDB: d1lqma_, d1lqmc_, d1lqme_, d1lqmg_

Details for d1lqmh_

PDB Entry: 1lqm (more details), 3.2 Å

PDB Description: escherichia coli uracil-dna glycosylase complex with uracil-dna glycosylase inhibitor protein
PDB Compounds: (H:) uracil-DNA glycosylase inhibitor

SCOP Domain Sequences for d1lqmh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lqmh_ d.17.5.1 (H:) Uracil-DNA glycosylase inhibitor protein {Bacteriophage pbs2 [TaxId: 10684]}
mtnlsdiieketgkqlviqesilmlpeeveevignkpesdilvhtaydestdenvmllts
dapeykpwalviqdsngenkikml

SCOP Domain Coordinates for d1lqmh_:

Click to download the PDB-style file with coordinates for d1lqmh_.
(The format of our PDB-style files is described here.)

Timeline for d1lqmh_: