Lineage for d2j7pd1 (2j7p D:22-78)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1483413Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1484027Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. Family a.24.13.0: automated matches [229049] (1 protein)
    not a true family
  6. Protein automated matches [229050] (2 species)
    not a true protein
  7. Species Thermus aquaticus [TaxId:271] [255075] (3 PDB entries)
  8. 1484094Domain d2j7pd1: 2j7p D:22-78 [138123]
    Other proteins in same PDB: d2j7pa1, d2j7pa2, d2j7pb1, d2j7pb2, d2j7pd2, d2j7pe2
    automated match to d1okkd1
    protein/RNA complex; complexed with edo, gnp, iod, k, mg

Details for d2j7pd1

PDB Entry: 2j7p (more details), 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2j7pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7pd1 a.24.13.0 (D:22-78) automated matches {Thermus aquaticus [TaxId: 271]}
ipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

SCOPe Domain Coordinates for d2j7pd1:

Click to download the PDB-style file with coordinates for d2j7pd1.
(The format of our PDB-style files is described here.)

Timeline for d2j7pd1: