Lineage for d2j7pd1 (2j7p D:22-78)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 637916Fold a.24: Four-helical up-and-down bundle [47161] (27 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 638207Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 638208Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)
  6. 638212Protein Signal recognition particle receptor, FtsY [47368] (3 species)
  7. 638218Species Thermus aquaticus [TaxId:271] [101122] (5 PDB entries)
  8. 638221Domain d2j7pd1: 2j7p D:22-78 [138123]
    Other proteins in same PDB: d2j7pa1, d2j7pa2, d2j7pb1, d2j7pb2, d2j7pd2, d2j7pe2
    automatically matched to d1okkd1
    complexed with edo, gnp, iod, k, mg

Details for d2j7pd1

PDB Entry: 2j7p (more details), 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
PDB Compounds: (D:) cell division protein ftsy

SCOP Domain Sequences for d2j7pd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7pd1 a.24.13.1 (D:22-78) Signal recognition particle receptor, FtsY {Thermus aquaticus [TaxId: 271]}
ipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

SCOP Domain Coordinates for d2j7pd1:

Click to download the PDB-style file with coordinates for d2j7pd1.
(The format of our PDB-style files is described here.)

Timeline for d2j7pd1: