SCOPe 2.08: Domain d2j7pd1: 2j7p D:22-78

Lineage for d2j7pd1 (2j7p D:22-78)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.0: automated matches [229049] (1 protein)
   not a true family

6. Protein automated matches [229050] (7 species)
   not a true protein

7. Species Thermus aquaticus [TaxId:271] [255075] (4 PDB entries)

8. Domain d2j7pd1: 2j7p D:22-78 [138123]
   Other proteins in same PDB: d2j7pa1, d2j7pa2, d2j7pb1, d2j7pb2, d2j7pd2, d2j7pe2
   automated match to d1okkd1
   protein/RNA complex; complexed with edo, gnp, iod, k, mg

Details for d2j7pd1

PDB Entry: 2j7p, 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy

PDB Compounds: (D:) cell division protein ftsy

SCOPe Domain Sequences for d2j7pd1:

Sequence; same for both SEQRES and ATOM records:

>d2j7pd1 a.24.13.0 (D:22-78) automated matches {Thermus aquaticus [TaxId: 271]}
ipwggnleevleelemallaadvglsateeilqevrasgrkdlkeavkeklvgmlep

Timeline for d2j7pd1:

• d2j7pd1 first appeared in SCOP 1.73
  
• d2j7pd1 appears in SCOPe 2.07