| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
| Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries) |
| Domain d2j7pb2: 2j7p B:89-294 [138122] Other proteins in same PDB: d2j7pa1, d2j7pb1, d2j7pd1, d2j7pd2, d2j7pe1, d2j7pe2 automatically matched to d2ffha3 protein/RNA complex; complexed with edo, gnp, iod, k, mg |
PDB Entry: 2j7p (more details), 1.97 Å
SCOPe Domain Sequences for d2j7pb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j7pb2 c.37.1.10 (B:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm
Timeline for d2j7pb2: