SCOP 1.73: Domain d2j7pb2: 2j7p B:89-294

Lineage for d2j7pb2 (2j7p B:89-294)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (13 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (18 PDB entries)

8. Domain d2j7pb2: 2j7p B:89-294 [138122]
   Other proteins in same PDB: d2j7pa1, d2j7pb1, d2j7pd1, d2j7pd2, d2j7pe1, d2j7pe2
   automatically matched to d2ffha3
   complexed with edo, gnp, iod, k, mg

Details for d2j7pb2

PDB Entry: 2j7p, 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy

PDB Compounds: (B:) signal recognition particle protein

SCOP Domain Sequences for d2j7pb2:

Sequence; same for both SEQRES and ATOM records:

>d2j7pb2 c.37.1.10 (B:89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

Timeline for d2j7pb2:

• d2j7pb2 is new in SCOP 1.73
  
• d2j7pb2 appears in SCOP 1.75
  
• d2j7pb2 appears in the current release, SCOPe 2.08