Lineage for d2j7pe2 (2j7p E:97-303)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 987024Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 987025Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 988943Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 989061Protein GTPase domain of the signal recognition particle receptor FtsY [52666] (3 species)
  7. 989068Species Thermus aquaticus [TaxId:271] [102374] (5 PDB entries)
  8. 989071Domain d2j7pe2: 2j7p E:97-303 [138126]
    Other proteins in same PDB: d2j7pa1, d2j7pa2, d2j7pb1, d2j7pb2, d2j7pd1, d2j7pe1
    automatically matched to d1okkd2
    protein/RNA complex; complexed with edo, gnp, iod, k, mg

Details for d2j7pe2

PDB Entry: 2j7p (more details), 1.97 Å

PDB Description: gmppnp-stabilized ng domain complex of the srp gtpases ffh and ftsy
PDB Compounds: (E:) cell division protein ftsy

SCOPe Domain Sequences for d2j7pe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j7pe2 c.37.1.10 (E:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]}
pvepkgrvvlvvgvngvgktttiaklgryyqnlgkkvmfcagdtfraaggtqlsewgkrl
sipviqgpegtdpaalaydavqamkargydllfvdtagrlhtkhnlmeelkkvkraiaka
dpeepkevwlvldavtgqngleqakkfheavgltgvivtkldgtakggvlipivrtlkvp
ikfvgvgegpddlqpfdpeafvealle

SCOPe Domain Coordinates for d2j7pe2:

Click to download the PDB-style file with coordinates for d2j7pe2.
(The format of our PDB-style files is described here.)

Timeline for d2j7pe2: