SCOPe 2.08: Domain d2j6hb2: 2j6h B:1-240

Lineage for d2j6hb2 (2j6h B:1-240)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [233107] (3 PDB entries)

8. Domain d2j6hb2: 2j6h B:1-240 [138087]
   Other proteins in same PDB: d2j6ha1, d2j6hb1
   automated match to d4amva2
   complexed with g6q, onl

Details for d2j6hb2

PDB Entry: 2j6h, 2.35 Å

PDB Description: e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo-l-norleucine

PDB Compounds: (B:) glucosamine-fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2j6hb2:

Sequence; same for both SEQRES and ATOM records:

>d2j6hb2 d.153.1.0 (B:1-240) automated matches {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

Timeline for d2j6hb2:

• d2j6hb2 first appeared in SCOP 1.73
  
• d2j6hb2 appears in SCOPe 2.07