![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
![]() | Superfamily c.80.1: SIS domain [53697] (4 families) ![]() |
![]() | Family c.80.1.1: double-SIS domain [53698] (5 proteins) duplication: consists of two SIS domains related by pseudo dyad |
![]() | Protein automated matches [227069] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [233109] (5 PDB entries) |
![]() | Domain d2j6hb1: 2j6h B:241-608 [138086] Other proteins in same PDB: d2j6ha2, d2j6hb2 automated match to d4amva1 complexed with g6q, onl |
PDB Entry: 2j6h (more details), 2.35 Å
SCOPe Domain Sequences for d2j6hb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j6hb1 c.80.1.1 (B:241-608) automated matches {Escherichia coli [TaxId: 562]} dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn laksvtve
Timeline for d2j6hb1: