Lineage for d2j6ha2 (2j6h A:1-240)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996342Species Escherichia coli [TaxId:562] [233107] (3 PDB entries)
  8. 2996343Domain d2j6ha2: 2j6h A:1-240 [138085]
    Other proteins in same PDB: d2j6ha1, d2j6hb1
    automated match to d4amva2
    complexed with g6q, onl

Details for d2j6ha2

PDB Entry: 2j6h (more details), 2.35 Å

PDB Description: e. coli glucosamine-6-p synthase in complex with glucose-6p and 5-oxo-l-norleucine
PDB Compounds: (A:) glucosamine-fructose-6-phosphate aminotransferase

SCOPe Domain Sequences for d2j6ha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j6ha2 d.153.1.0 (A:1-240) automated matches {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOPe Domain Coordinates for d2j6ha2:

Click to download the PDB-style file with coordinates for d2j6ha2.
(The format of our PDB-style files is described here.)

Timeline for d2j6ha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2j6ha1