Class b: All beta proteins [48724] (180 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) |
Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
Protein automated matches [232762] (1 species) not a true protein |
Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
Domain d2j57g_: 2j57 G: [138025] Other proteins in same PDB: d2j57a_, d2j57b_, d2j57c_, d2j57d_, d2j57k_, d2j57l_, d2j57m_, d2j57n_ automated match to d3l4od_ complexed with cu |
PDB Entry: 2j57 (more details), 2.25 Å
SCOPe Domain Sequences for d2j57g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j57g_ b.69.2.0 (G:) automated matches {Paracoccus denitrificans [TaxId: 318586]} eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg eelrsvnqlghgpqvittadmg
Timeline for d2j57g_: