Lineage for d2j57m_ (2j57 M:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034451Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 3034452Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 3034453Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 3034510Protein automated matches [190303] (3 species)
    not a true protein
  7. 3034511Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)
  8. 3034524Domain d2j57m_: 2j57 M: [145654]
    Other proteins in same PDB: d2j57a_, d2j57b_, d2j57c_, d2j57d_, d2j57g_, d2j57h_, d2j57i_, d2j57j_
    automated match to d1mg2b_
    complexed with cu

Details for d2j57m_

PDB Entry: 2j57 (more details), 2.25 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-quinol in complex with amicyanin.
PDB Compounds: (M:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2j57m_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j57m_ g.21.1.1 (M:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2j57m_:

Click to download the PDB-style file with coordinates for d2j57m_.
(The format of our PDB-style files is described here.)

Timeline for d2j57m_: