Lineage for d2j57g_ (2j57 G:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2418201Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2418231Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2418267Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2418268Protein automated matches [232762] (1 species)
    not a true protein
  7. 2418269Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2418298Domain d2j57g_: 2j57 G: [138025]
    Other proteins in same PDB: d2j57a_, d2j57b_, d2j57c_, d2j57d_, d2j57k_, d2j57l_, d2j57m_, d2j57n_
    automated match to d3l4od_
    complexed with cu

Details for d2j57g_

PDB Entry: 2j57 (more details), 2.25 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase n-quinol in complex with amicyanin.
PDB Compounds: (G:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2j57g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j57g_ b.69.2.0 (G:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
eaetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvi
dgeagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptad
ielpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhi
fptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpt
ytgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdew
rhktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesg
eelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2j57g_:

Click to download the PDB-style file with coordinates for d2j57g_.
(The format of our PDB-style files is described here.)

Timeline for d2j57g_: