![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) ![]() |
![]() | Family b.69.2.0: automated matches [232760] (1 protein) not a true family |
![]() | Protein automated matches [232762] (1 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries) |
![]() | Domain d3l4od_: 3l4o D: [232782] Other proteins in same PDB: d3l4oc_, d3l4oe_ automated match to d2madh_ complexed with 1pe, act, ca, hec, pg4 |
PDB Entry: 3l4o (more details), 2.05 Å
SCOPe Domain Sequences for d3l4od_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l4od_ b.69.2.0 (D:) automated matches {Paracoccus denitrificans [TaxId: 318586]} qetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvidgeagr vigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadielpda prflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhifptapd tffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwptytgkih qidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewrhktas rfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesgeelrsv nqlghgpqvittadmg
Timeline for d3l4od_: