Lineage for d2j55a_ (2j55 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2036241Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2036242Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2036243Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 protein domains)
    mono-domain proteins
  6. 2036244Protein Amicyanin [49505] (2 species)
  7. 2036245Species Paracoccus denitrificans [TaxId:266] [49506] (35 PDB entries)
    Uniprot P22364
  8. 2036306Domain d2j55a_: 2j55 A: [138013]
    Other proteins in same PDB: d2j55h_, d2j55j_, d2j55l1, d2j55m_
    automated match to d1aac__
    complexed with cu, gol

Details for d2j55a_

PDB Entry: 2j55 (more details), 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.
PDB Compounds: (A:) amicyanin

SCOPe Domain Sequences for d2j55a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j55a_ b.6.1.1 (A:) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

SCOPe Domain Coordinates for d2j55a_:

Click to download the PDB-style file with coordinates for d2j55a_.
(The format of our PDB-style files is described here.)

Timeline for d2j55a_: