Lineage for d2j55j_ (2j55 J:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2065850Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (4 families) (S)
  5. 2065886Family b.69.2.0: automated matches [232760] (1 protein)
    not a true family
  6. 2065887Protein automated matches [232762] (1 species)
    not a true protein
  7. 2065888Species Paracoccus denitrificans [TaxId:318586] [232763] (18 PDB entries)
  8. 2065930Domain d2j55j_: 2j55 J: [138016]
    Other proteins in same PDB: d2j55a_, d2j55b_, d2j55l1, d2j55m_
    automated match to d3l4od_
    complexed with cu, gol

Details for d2j55j_

PDB Entry: 2j55 (more details), 2.15 Å

PDB Description: x-ray reduced paraccocus denitrificans methylamine dehydrogenase o-quinone in complex with amicyanin.
PDB Compounds: (J:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2j55j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j55j_ b.69.2.0 (J:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
aetqaqetqgqaaaraaaadlaagqddeprileapapdarrvyvndpahfaavtqqfvid
geagrvigmidggflpnpvvaddgsfiahastvfsriargertdyvevfdpvtllptadi
elpdaprflvgtypwmtsltpdgktllfyqfspapavgvvdlegkafkrmldvpdcyhif
ptapdtffmhcrdgslakvafgtegtpeithtevfhpedeflinhpaysqkagrlvwpty
tgkihqidlssgdakflpavealteaeradgwrpggwqqvayhraldriyllvdqrdewr
hktasrfvvvldaktgerlakfemgheidsinvsqdekpllyalstgdktlyihdaesge
elrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2j55j_:

Click to download the PDB-style file with coordinates for d2j55j_.
(The format of our PDB-style files is described here.)

Timeline for d2j55j_: